PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g027190m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MIKC_MADS
Protein Properties Length: 228aa    MW: 25360 Da    PI: 8.6244
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g027190mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF81.46e-261057249
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       +i+n + rqvtfskRr g++KKAeELSvLCdaev viifs tgkl+e 
  orange1.1g027190m 10 KIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFES 57
                       69*******************************************985 PP

2K-box52.22.7e-18851711399
              K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        + +  + ++  L +ei    r++R++ GedL+ L+++eLq+Le+ Le++l+++ ++K + ++++i++l +k  +l eenk+L++k++
  orange1.1g027190m  85 ELQLENSKYLSLSREIADKSRQLRQMRGEDLHGLTIEELQHLETMLEQGLSRVLQTKGDRIMNEISTLERKGAKLLEENKNLKQKVA 171
                        45566677888999999999*****************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.96E-29173IPR002100Transcription factor, MADS-box
SMARTSM004327.3E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.511161IPR002100Transcription factor, MADS-box
CDDcd002652.34E-36275No hitNo description
PRINTSPR004041.5E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.2E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.80386176IPR002487Transcription factor, K-box
PfamPF014863.6E-1691170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MAREKIKIRK IDNITARQVT FSKRRRGLFK KAEELSVLCD AEVGVIIFSA TGKLFESSSS  60
SMKDIIARYN MHSSNISKLN HPSLELQLEN SKYLSLSREI ADKSRQLRQM RGEDLHGLTI  120
EELQHLETML EQGLSRVLQT KGDRIMNEIS TLERKGAKLL EENKNLKQKV ASSCKGKRVV  180
LVDSDIAIQE EGMSSESVNN VCSCSSGPPP EDDSSDTSLK LGLPYSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-17173173Myocyte-specific enhancer factor 2B
1tqe_R3e-17173173Myocyte-specific enhancer factor 2B
1tqe_Q3e-17173173Myocyte-specific enhancer factor 2B
1tqe_P3e-17173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.71190.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006472470.11e-157PREDICTED: MADS-box protein SVP
RefseqXP_006472471.11e-157PREDICTED: MADS-box protein SVP
SwissprotQ9FVC13e-91SVP_ARATH; MADS-box protein SVP
TrEMBLQ6RF311e-126Q6RF31_POPTO; MADS box transcription factor
STRINGVIT_18s0001g07460.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41902747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-75MIKC_MADS family protein